General Information

  • ID:  hor003881
  • Uniprot ID:  P11280
  • Protein name:  Corticotropin-like intermediary peptide
  • Gene name:  pomc
  • Organism:  Neovison vison (American mink) (Mustela vison)
  • Family:  POMC family
  • Source:  animal
  • Expression:  ACTH and MSH are produced by the pituitary gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Neogale (genus), Mustelinae (subfamily), Mustelidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  PVKVYPNGAEDESAEAFPLEF
  • Length:  21
  • Propeptide:  SEPGRREGKRSYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEFKRELAGERPEPALGPEGAAEGMAALADLEYGLVAKAEVAEKKDDGPYKMEHFRWGSPGKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ
  • Signal peptide:  NA
  • Modification:  T13 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [Corticotropin]: Stimulates the adrenal glands to release cortisol.; [Melanocyte-stimulating hormone alpha]: Anorexigenic peptide. Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Melanocyte-stimulating hormone beta]: Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Beta-endorphin]: Endogenous orexigenic opiate.; [Met-enkephalin]: Endogenous opiate.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P11280-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003881_AF2.pdbhor003881_ESM.pdb

Physical Information

Mass: 266642 Formula: C106H153N23O35
Absent amino acids: CHIMQRTW Common amino acids: E
pI: 3.67 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 8
Hydrophobicity: -42.86 Boman Index: -2636
Half-Life: >20 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: ? Aliphatic Index 60.48
Instability Index: 3188.1 Extinction Coefficient cystines: 1490
Absorbance 280nm: 74.5

Literature

  • PubMed ID:  3382437
  • Title:  [Synthesis, Cloning and Primary Structure of cDNA for Proopiomelanocortin From the Pituitary Gland of the Mink (Mustella Vison)]